Lineage for d2ckbb2 (2ckb B:118-247)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 104617Protein T-cell antigen receptor [49125] (6 species)
  7. 104649Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (7 PDB entries)
  8. 104658Domain d2ckbb2: 2ckb B:118-247 [21569]
    Other proteins in same PDB: d2ckba1, d2ckbb1, d2ckbc1, d2ckbd1, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl1, d2ckbm1

Details for d2ckbb2

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOP Domain Coordinates for d2ckbb2:

Click to download the PDB-style file with coordinates for d2ckbb2.
(The format of our PDB-style files is described here.)

Timeline for d2ckbb2: