![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries) |
![]() | Domain d1nfdd2: 1nfd D:118-247 [21568] Other proteins in same PDB: d1nfda1, d1nfdb1, d1nfdc1, d1nfdd1, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2 complexed with nag |
PDB Entry: 1nfd (more details), 2.8 Å
SCOP Domain Sequences for d1nfdd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfdd2 b.1.1.2 (D:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain} dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgradc
Timeline for d1nfdd2: