![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
![]() | Domain d1nfdb2: 1nfd B:118-247 [21567] Other proteins in same PDB: d1nfda1, d1nfdb1, d1nfdc1, d1nfdd1, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2 complexed with nag, ndg |
PDB Entry: 1nfd (more details), 2.8 Å
SCOPe Domain Sequences for d1nfdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfdb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgradc
Timeline for d1nfdb2: