Lineage for d3r8xa1 (3r8x A:1-207)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892613Protein automated matches [227063] (3 species)
    not a true protein
  7. 2892619Species Yersinia pestis [TaxId:632] [226110] (1 PDB entry)
  8. 2892620Domain d3r8xa1: 3r8x A:1-207 [215665]
    Other proteins in same PDB: d3r8xa2, d3r8xa3
    automated match to d1fmta2
    protein/RNA complex; complexed with gol, met, moe, trs

Details for d3r8xa1

PDB Entry: 3r8x (more details), 2.26 Å

PDB Description: Crystal Structure of Methionyl-tRNA Formyltransferase from Yersinia pestis complexed with L-methionine
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3r8xa1:

Sequence, based on SEQRES records: (download)

>d3r8xa1 c.65.1.1 (A:1-207) automated matches {Yersinia pestis [TaxId: 632]}
msdslriifagtpdfaarhlgallssqhkivgvftqpdrpagrgnkltpspvkilaehhg
ipvfqpkslrpeenqhlvadlnadimvvvayglilpaavlamprlgcinvhgsllprwrg
aapiqrsvwagdektgitimqmdigldtgamlhkiecaiqpedtsatlydklaqlgpqgl
litlqqlaagtalaevqnetqatyaek

Sequence, based on observed residues (ATOM records): (download)

>d3r8xa1 c.65.1.1 (A:1-207) automated matches {Yersinia pestis [TaxId: 632]}
msdslriifagtpdfaarhlgallssqhkivgvftqpdrpltpspvkilaehhgipvfqp
kslrpeenqhlvadlnadimvvvayglilpaavlamprlgcinvhgsllprwrgaapiqr
svwagdektgitimqmdigldtgamlhkiecaiqpedtsatlydklaqlgpqgllitlqq
laagtalaevqnetqatyaek

SCOPe Domain Coordinates for d3r8xa1:

Click to download the PDB-style file with coordinates for d3r8xa1.
(The format of our PDB-style files is described here.)

Timeline for d3r8xa1: