Lineage for d3r87a_ (3r87 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944529Species Photobacterium profundum [TaxId:74109] [196962] (2 PDB entries)
  8. 2944530Domain d3r87a_: 3r87 A: [215656]
    automated match to d4i45a_

Details for d3r87a_

PDB Entry: 3r87 (more details), 1.05 Å

PDB Description: Crystal Structure of Orf6 protein from Photobacterium profundum
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3r87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r87a_ d.38.1.0 (A:) automated matches {Photobacterium profundum [TaxId: 74109]}
mskiyhhpvqiyyedtdhsgvvyhpnflkyferarehvidsdklatlwndhglgfavyka
nmifqdgvefaeicdirtsftldgkyktlwrqevwrpgasraavigdiemvcldkekrlq
pvpadilasmma

SCOPe Domain Coordinates for d3r87a_:

Click to download the PDB-style file with coordinates for d3r87a_.
(The format of our PDB-style files is described here.)

Timeline for d3r87a_: