Lineage for d1tcrb2 (1tcr B:118-247)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 366220Protein T-cell antigen receptor [49125] (6 species)
  7. 366266Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries)
  8. 366274Domain d1tcrb2: 1tcr B:118-247 [21564]
    Other proteins in same PDB: d1tcra1, d1tcrb1
    complexed with fuc, man, nag, so4

Details for d1tcrb2

PDB Entry: 1tcr (more details), 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone

SCOP Domain Sequences for d1tcrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcrb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOP Domain Coordinates for d1tcrb2:

Click to download the PDB-style file with coordinates for d1tcrb2.
(The format of our PDB-style files is described here.)

Timeline for d1tcrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tcrb1