Lineage for d1tcrb2 (1tcr B:118-247)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 104617Protein T-cell antigen receptor [49125] (6 species)
  7. 104649Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (7 PDB entries)
  8. 104653Domain d1tcrb2: 1tcr B:118-247 [21564]
    Other proteins in same PDB: d1tcra1, d1tcrb1

Details for d1tcrb2

PDB Entry: 1tcr (more details), 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone

SCOP Domain Sequences for d1tcrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcrb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOP Domain Coordinates for d1tcrb2:

Click to download the PDB-style file with coordinates for d1tcrb2.
(The format of our PDB-style files is described here.)

Timeline for d1tcrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tcrb1