Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (25 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [226108] (2 PDB entries) |
Domain d3r7ka1: 3r7k A:21-248 [215630] Other proteins in same PDB: d3r7ka2, d3r7kb2, d3r7kc2, d3r7kd2 automated match to d1rx0a2 complexed with fda, k |
PDB Entry: 3r7k (more details), 2.5 Å
SCOPe Domain Sequences for d3r7ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r7ka1 e.6.1.0 (A:21-248) automated matches {Mycobacterium abscessus [TaxId: 561007]} peawttperralsqmarsfvereiapklaewehvgeiprdlhlnaaevgllgigfpeevg gsggnaidsalvteailaaggstgvcaalfthgialphiaangsdalieryvrptlagkm igslgvtepgagsdvanlrtravregdtyvvngaktfitsgvradfvttavrtggpgygg vsllvidknspgfevsrrldkmgwrcsdtaelsfvdvrvpadnlvgae
Timeline for d3r7ka1: