Lineage for d1sbba2 (1sbb A:118-246)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 9314Protein T-cell antigen receptor [49125] (4 species)
  7. 9336Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (7 PDB entries)
  8. 9338Domain d1sbba2: 1sbb A:118-246 [21562]
    Other proteins in same PDB: d1sbba1, d1sbbb1, d1sbbb2, d1sbbc1, d1sbbd1, d1sbbd2

Details for d1sbba2

PDB Entry: 1sbb (more details), 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb

SCOP Domain Sequences for d1sbba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbba2 b.1.1.2 (A:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOP Domain Coordinates for d1sbba2:

Click to download the PDB-style file with coordinates for d1sbba2.
(The format of our PDB-style files is described here.)

Timeline for d1sbba2: