Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (52 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [226340] (2 PDB entries) |
Domain d3r6sf2: 3r6s F:148-227 [215608] Other proteins in same PDB: d3r6sa1, d3r6sb1, d3r6sc1, d3r6sd1, d3r6se1, d3r6sf1 automated match to d1i5za1 complexed with cmp, hez |
PDB Entry: 3r6s (more details), 2.38 Å
SCOPe Domain Sequences for d3r6sf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r6sf2 a.4.5.0 (F:148-227) automated matches {Corynebacterium glutamicum [TaxId: 1718]} dvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwi rlegksvlivdtehlarrar
Timeline for d3r6sf2: