Lineage for d1qsfd2 (1qsf D:118-206)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550341Protein T-cell antigen receptor [49125] (6 species)
  7. 550342Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (9 PDB entries)
  8. 550351Domain d1qsfd2: 1qsf D:118-206 [21560]
    Other proteins in same PDB: d1qsfa1, d1qsfa2, d1qsfb_, d1qsfd1, d1qsfe1

Details for d1qsfd2

PDB Entry: 1qsf (more details), 2.8 Å

PDB Description: structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a

SCOP Domain Sequences for d1qsfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsfd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOP Domain Coordinates for d1qsfd2:

Click to download the PDB-style file with coordinates for d1qsfd2.
(The format of our PDB-style files is described here.)

Timeline for d1qsfd2: