Lineage for d3r5xb1 (3r5x B:94-303)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671442Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1671443Protein automated matches [226904] (25 species)
    not a true protein
  7. 1671444Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226104] (1 PDB entry)
  8. 1671446Domain d3r5xb1: 3r5x B:94-303 [215591]
    Other proteins in same PDB: d3r5xa2, d3r5xb2, d3r5xc2, d3r5xd2
    automated match to d1e4ea2
    complexed with acy, atp, ca, edo, mg

Details for d3r5xb1

PDB Entry: 3r5x (more details), 2 Å

PDB Description: crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3r5xb1:

Sequence, based on SEQRES records: (download)

>d3r5xb1 d.142.1.0 (B:94-303) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpnsggssvgvkivydkd
elismletvfewdsevviekyikgeeitcsifdgkqlpiisirhaaeffdynakyddast
ieevielpaelkervnkaslacykalkcsvyarvdmmvkdgipyvmevntlpgmtqasll
pksadaagihysklldmiietslrvrkeeg

Sequence, based on observed residues (ATOM records): (download)

>d3r5xb1 d.142.1.0 (B:94-303) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpnsggvkivydkdelis
mletvfewdsevviekyikgeeitcsifdgkqlpiisirhaaeffstieevielpaelke
rvnkaslacykalkcsvyarvdmmvkdgipyvmevntlpgmtqasllpksadaagihysk
lldmiietslrvrkeeg

SCOPe Domain Coordinates for d3r5xb1:

Click to download the PDB-style file with coordinates for d3r5xb1.
(The format of our PDB-style files is described here.)

Timeline for d3r5xb1: