SCOPe 2.06: Domain d3r5fa2: 3r5f A:140-365

Lineage for d3r5fa2 (3r5f A:140-365)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (32 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:291331] [226136] (1 PDB entry)

8. Domain d3r5fa2: 3r5f A:140-365 [215589]
   Other proteins in same PDB: d3r5fa1
   automated match to d1ehia2
   complexed with atp, mg

Details for d3r5fa2

PDB Entry: 3r5f, 2.07 Å

PDB Description: Crystal structure of D-alanine-D-alnine ligase from Xanthomonas oryzae pv. oryzae with ATP

PDB Compounds: (A:) D-alanine--D-alanine ligase 1

SCOPe Domain Sequences for d3r5fa2:

Sequence, based on SEQRES records:

>d3r5fa2 d.142.1.0 (A:140-365) automated matches {Xanthomonas oryzae [TaxId: 291331]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqllrsave

Sequence, based on observed residues (ATOM records):

>d3r5fa2 d.142.1.0 (A:140-365) automated matches {Xanthomonas oryzae [TaxId: 291331]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvveivipadida
qtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasg
ldyrglitrlielalerhtddqllrsave

Timeline for d3r5fa2:

• d3r5fa2 first appeared in SCOPe 2.03
  
• d3r5fa2 appears in SCOPe 2.05
  
• d3r5fa2 appears in SCOPe 2.07
  
• d3r5fa2 appears in the current release, SCOPe 2.08