Lineage for d3r5fa2 (3r5f A:140-365)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671442Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1671443Protein automated matches [226904] (25 species)
    not a true protein
  7. 1671548Species Xanthomonas oryzae [TaxId:291331] [226136] (1 PDB entry)
  8. 1671549Domain d3r5fa2: 3r5f A:140-365 [215589]
    Other proteins in same PDB: d3r5fa1
    automated match to d1ehia2
    complexed with atp, mg

Details for d3r5fa2

PDB Entry: 3r5f (more details), 2.07 Å

PDB Description: Crystal structure of D-alanine-D-alnine ligase from Xanthomonas oryzae pv. oryzae with ATP
PDB Compounds: (A:) D-alanine--D-alanine ligase 1

SCOPe Domain Sequences for d3r5fa2:

Sequence, based on SEQRES records: (download)

>d3r5fa2 d.142.1.0 (A:140-365) automated matches {Xanthomonas oryzae [TaxId: 291331]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqllrsave

Sequence, based on observed residues (ATOM records): (download)

>d3r5fa2 d.142.1.0 (A:140-365) automated matches {Xanthomonas oryzae [TaxId: 291331]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvveivipadida
qtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasg
ldyrglitrlielalerhtddqllrsave

SCOPe Domain Coordinates for d3r5fa2:

Click to download the PDB-style file with coordinates for d3r5fa2.
(The format of our PDB-style files is described here.)

Timeline for d3r5fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r5fa1