Lineage for d1qrnd2 (1qrn D:118-206)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 454519Protein T-cell antigen receptor [49125] (6 species)
  7. 454520Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (9 PDB entries)
  8. 454527Domain d1qrnd2: 1qrn D:118-206 [21558]
    Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb_, d1qrnd1, d1qrne1

Details for d1qrnd2

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

SCOP Domain Sequences for d1qrnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrnd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdkdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOP Domain Coordinates for d1qrnd2:

Click to download the PDB-style file with coordinates for d1qrnd2.
(The format of our PDB-style files is described here.)

Timeline for d1qrnd2: