Class b: All beta proteins [48724] (180 folds) |
Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
Protein automated matches [190516] (5 species) not a true protein |
Species Sweet potato (Ipomoea batatas) [TaxId:4120] [193613] (4 PDB entries) |
Domain d3r50b_: 3r50 B: [215573] automated match to d4ddnb_ |
PDB Entry: 3r50 (more details), 2.27 Å
SCOPe Domain Sequences for d3r50b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r50b_ b.77.3.0 (B:) automated matches {Sweet potato (Ipomoea batatas) [TaxId: 4120]} malqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptd iitvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganag tpfnikipdgnkivgffgnsgwyvdaigayytak
Timeline for d3r50b_:
View in 3D Domains from other chains: (mouse over for more information) d3r50a_, d3r50c_, d3r50d_, d3r50e_ |