Lineage for d3r3ha_ (3r3h A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612879Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1612880Protein automated matches [190689] (47 species)
    not a true protein
  7. 1613001Species Legionella pneumophila [TaxId:272624] [226103] (1 PDB entry)
  8. 1613002Domain d3r3ha_: 3r3h A: [215565]
    automated match to d2hnkc_

Details for d3r3ha_

PDB Entry: 3r3h (more details), 2.65 Å

PDB Description: crystal structure of o-methyltransferase from legionella pneumophila
PDB Compounds: (A:) O-methyltransferase, SAM-dependent

SCOPe Domain Sequences for d3r3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3ha_ c.66.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
khlsltpelykylldislrehpalaalrketstmelanmqvapeqaqfmqmlirltrakk
vlelgtftgysalamslalpddgqvitcdinegwtkhahpywreakqehkiklrlgpald
tlhsllneggehqfdfifidadktnylnyyelalklvtpkgliaidnifwdgkvidpndt
sgqtreikklnqvikndsrvfvsllaiadgmflvqpi

SCOPe Domain Coordinates for d3r3ha_:

Click to download the PDB-style file with coordinates for d3r3ha_.
(The format of our PDB-style files is described here.)

Timeline for d3r3ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3r3hb_