![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (47 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:272624] [226103] (1 PDB entry) |
![]() | Domain d3r3ha_: 3r3h A: [215565] automated match to d2hnkc_ |
PDB Entry: 3r3h (more details), 2.65 Å
SCOPe Domain Sequences for d3r3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r3ha_ c.66.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]} khlsltpelykylldislrehpalaalrketstmelanmqvapeqaqfmqmlirltrakk vlelgtftgysalamslalpddgqvitcdinegwtkhahpywreakqehkiklrlgpald tlhsllneggehqfdfifidadktnylnyyelalklvtpkgliaidnifwdgkvidpndt sgqtreikklnqvikndsrvfvsllaiadgmflvqpi
Timeline for d3r3ha_: