Lineage for d1fytd2 (1fyt D:118-203)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517073Protein T-cell antigen receptor [49125] (7 species)
  7. 1517074Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries)
  8. 1517087Domain d1fytd2: 1fyt D:118-203 [21556]
    Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd1, d1fyte1
    complexed with nag

Details for d1fytd2

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1
PDB Compounds: (D:) T-cell receptor alpha chain

SCOPe Domain Sequences for d1fytd2:

Sequence, based on SEQRES records: (download)

>d1fytd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records): (download)

>d1fytd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava
wsnksdfacanafnnsiipedtf

SCOPe Domain Coordinates for d1fytd2:

Click to download the PDB-style file with coordinates for d1fytd2.
(The format of our PDB-style files is described here.)

Timeline for d1fytd2: