Lineage for d1fytd2 (1fyt D:118-203)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein T-cell antigen receptor [49125] (6 species) 
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (5 PDB entries) 
Domain d1fytd2: 1fyt D:118-203 [21556]
Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd1, d1fyte1
Details for d1fytd2
PDB Entry: 1fyt (more details), 2.6 Å
PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1
SCOP Domain Sequences for d1fytd2:
Sequence, based on SEQRES records: (download)
>d1fytd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf
Sequence, based on observed residues (ATOM records): (download)
>d1fytd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava
wsnksdfacanafnnsiipedtf
SCOP Domain Coordinates for d1fytd2:
Click to download the PDB-style file with coordinates for d1fytd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fytd2:
View in 3D
