SCOPe 2.07: Domain d3r2tb1: 3r2t B:39-128

Lineage for d3r2tb1 (3r2t B:39-128)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries)

8. Domain d3r2tb1: 3r2t B:39-128 [215559]
   Other proteins in same PDB: d3r2ta2, d3r2tb2
   automated match to d1m4va1
   complexed with so4

Details for d3r2tb1

PDB Entry: 3r2t, 2.21 Å

PDB Description: 2.2 angstrom resolution crystal structure of superantigen-like protein from staphylococcus aureus subsp. aureus nctc 8325.

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3r2tb1:

Sequence; same for both SEQRES and ATOM records:

>d3r2tb1 b.40.2.0 (B:39-128) automated matches {Staphylococcus aureus [TaxId: 93061]}
rlydtnklhqyysgpsyeltnvsgqsqgyydsnvllfnqqnqkfqvfllgkdenkykekt
hgldvfavpelvdldgrifsvsgvtkknvk

Timeline for d3r2tb1:

• d3r2tb1 first appeared in SCOPe 2.03
  
• d3r2tb1 appears in SCOPe 2.06
  
• d3r2tb1 appears in the current release, SCOPe 2.08