Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
Protein automated matches [226841] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [226096] (8 PDB entries) |
Domain d3r2ta2: 3r2t A:129-232 [215558] Other proteins in same PDB: d3r2ta1, d3r2tb1 automated match to d2z8la2 complexed with so4 |
PDB Entry: 3r2t (more details), 2.21 Å
SCOPe Domain Sequences for d3r2ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r2ta2 d.15.6.0 (A:129-232) automated matches {Staphylococcus aureus [TaxId: 93061]} sifeslrtpnllvkkiddkdgfsidefffiqkeevslkeldfkirkllikkyklyegsad kgrivinmkdenkyeidlsdkldfermadvinseqiknievnlk
Timeline for d3r2ta2: