![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
![]() | Protein automated matches [226841] (6 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [226095] (2 PDB entries) |
![]() | Domain d3r2ia2: 3r2i A:127-232 [215556] Other proteins in same PDB: d3r2ia1 automated match to d1v1oa2 |
PDB Entry: 3r2i (more details), 2.3 Å
SCOPe Domain Sequences for d3r2ia2:
Sequence, based on SEQRES records: (download)
>d3r2ia2 d.15.6.0 (A:127-232) automated matches {Staphylococcus aureus [TaxId: 93062]} vrsvfgfvsnpslqvkkvdakngfsinelffiqkeevslkeldfkirklliekyrlykgt sdkgrivinmkdekkheidlseklsfermfdvmdskqiknievnln
>d3r2ia2 d.15.6.0 (A:127-232) automated matches {Staphylococcus aureus [TaxId: 93062]} vrsgfvsnpslqvkkvdakngfsinelffiqkeevslkeldfkirklliekyrlykgtsd kgrivinmkdekkheidlseklsfermfdvmdskqiknievnln
Timeline for d3r2ia2: