Lineage for d3r2ia2 (3r2i A:127-232)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934637Species Staphylococcus aureus [TaxId:93062] [226095] (2 PDB entries)
  8. 2934638Domain d3r2ia2: 3r2i A:127-232 [215556]
    Other proteins in same PDB: d3r2ia1
    automated match to d1v1oa2

Details for d3r2ia2

PDB Entry: 3r2i (more details), 2.3 Å

PDB Description: crystal structure of superantigen-like protein, exotoxin sacol0473 from staphylococcus aureus subsp. aureus col
PDB Compounds: (A:) Exotoxin 5

SCOPe Domain Sequences for d3r2ia2:

Sequence, based on SEQRES records: (download)

>d3r2ia2 d.15.6.0 (A:127-232) automated matches {Staphylococcus aureus [TaxId: 93062]}
vrsvfgfvsnpslqvkkvdakngfsinelffiqkeevslkeldfkirklliekyrlykgt
sdkgrivinmkdekkheidlseklsfermfdvmdskqiknievnln

Sequence, based on observed residues (ATOM records): (download)

>d3r2ia2 d.15.6.0 (A:127-232) automated matches {Staphylococcus aureus [TaxId: 93062]}
vrsgfvsnpslqvkkvdakngfsinelffiqkeevslkeldfkirklliekyrlykgtsd
kgrivinmkdekkheidlseklsfermfdvmdskqiknievnln

SCOPe Domain Coordinates for d3r2ia2:

Click to download the PDB-style file with coordinates for d3r2ia2.
(The format of our PDB-style files is described here.)

Timeline for d3r2ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r2ia1