SCOPe 2.07: Domain d3r2ia1: 3r2i A:39-126

Lineage for d3r2ia1 (3r2i A:39-126)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225286] (4 PDB entries)

8. Domain d3r2ia1: 3r2i A:39-126 [215555]
   Other proteins in same PDB: d3r2ia2
   automated match to d1v1oa1

Details for d3r2ia1

PDB Entry: 3r2i, 2.3 Å

PDB Description: crystal structure of superantigen-like protein, exotoxin sacol0473 from staphylococcus aureus subsp. aureus col

PDB Compounds: (A:) Exotoxin 5

SCOPe Domain Sequences for d3r2ia1:

Sequence; same for both SEQRES and ATOM records:

>d3r2ia1 b.40.2.0 (A:39-126) automated matches {Staphylococcus aureus [TaxId: 93062]}
rkyyinmlhqyyseesfeptnisvksedyygsnvlnfkqrnkafkvfllgddknkykekt
hgldvfavpelidikggiysvggitkkn

Timeline for d3r2ia1:

• d3r2ia1 first appeared in SCOPe 2.03
  
• d3r2ia1 appears in SCOPe 2.06
  
• d3r2ia1 appears in the current release, SCOPe 2.08