SCOP 1.59: Domain d1g6rc2: 1g6r C:118-213

Lineage for d1g6rc2 (1g6r C:118-213)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (4 PDB entries)

8. Domain d1g6rc2: 1g6r C:118-213 [21555]
   Other proteins in same PDB: d1g6ra1, d1g6rb1, d1g6rc1, d1g6rd1, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl1, d1g6rm1

Details for d1g6rc2

PDB Entry: 1g6r, 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6rc2:

Sequence; same for both SEQRES and ATOM records:

>d1g6rc2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

Timeline for d1g6rc2:

• d1g6rc2 first appeared (with stable ids) in SCOP 1.55
  
• d1g6rc2 appears in SCOP 1.57
  
• d1g6rc2 appears in SCOP 1.61
  
• d1g6rc2 appears in the current release, SCOPe 2.08