SCOPe 2.03: Domain d3r1za1: 3r1z A:2-127

Lineage for d3r1za1 (3r1z A:2-127)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Francisella philomiragia [TaxId:484022] [226097] (5 PDB entries)

8. Domain d3r1za1: 3r1z A:2-127 [215535]
   Other proteins in same PDB: d3r1za2, d3r1zb2
   automated match to d1wufa2
   complexed with ala, dgl, glu, gol, so4

Details for d3r1za1

PDB Entry: 3r1z, 1.9 Å

PDB Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Complex with L-Ala-L-Glu and L-Ala-D-Glu

PDB Compounds: (A:) Enzyme of enolase superfamily

SCOPe Domain Sequences for d3r1za1:

Sequence; same for both SEQRES and ATOM records:

>d3r1za1 d.54.1.0 (A:2-127) automated matches {Francisella philomiragia [TaxId: 484022]}
vskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtl
qgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisv
akllga

Timeline for d3r1za1:

• d3r1za1 is new in SCOPe 2.03-stable
  
• d3r1za1 appears in SCOPe 2.04
  
• d3r1za1 appears in the current release, SCOPe 2.08