Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries) Uniprot P24941 |
Domain d3r1sa_: 3r1s A: [215533] automated match to d3pxqa_ complexed with edo, x73 |
PDB Entry: 3r1s (more details), 1.8 Å
SCOPe Domain Sequences for d3r1sa_:
Sequence, based on SEQRES records: (download)
>d3r1sa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
>d3r1sa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirtegvpstaireisllkelnhpniv klldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvl hrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystav diwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwa rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
Timeline for d3r1sa_: