SCOPe 2.06: Domain d2ckbc2: 2ckb C:118-213

Lineage for d2ckbc2 (2ckb C:118-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)

8. Domain d2ckbc2: 2ckb C:118-213 [21553]
   Other proteins in same PDB: d2ckba1, d2ckbb1, d2ckbc1, d2ckbd1, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckbc2

PDB Entry: 2ckb, 3 Å

PDB Description: structure of the 2c/kb/dev8 complex

PDB Compounds: (C:) alpha, beta t cell receptor

SCOPe Domain Sequences for d2ckbc2:

Sequence; same for both SEQRES and ATOM records:

>d2ckbc2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

Timeline for d2ckbc2:

• d2ckbc2 first appeared (with stable ids) in SCOP 1.55
  
• d2ckbc2 appears in SCOPe 2.05
  
• d2ckbc2 appears in SCOPe 2.07
  
• d2ckbc2 appears in the current release, SCOPe 2.08