Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries) |
Domain d2ckbc2: 2ckb C:118-213 [21553] Other proteins in same PDB: d2ckba1, d2ckbb1, d2ckbc1, d2ckbd1, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_ |
PDB Entry: 2ckb (more details), 3 Å
SCOPe Domain Sequences for d2ckbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckbc2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng aiawsnqtsftcqdifketnatypssdvpc
Timeline for d2ckbc2: