SCOPe 2.06: Domain d3r18a2: 3r18 A:344-466

Lineage for d3r18a2 (3r18 A:344-466)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225870] (6 PDB entries)

8. Domain d3r18a2: 3r18 A:344-466 [215526]
   Other proteins in same PDB: d3r18a1
   automated match to d1ogpa1
   complexed with mo, mte; mutant

Details for d3r18a2

PDB Entry: 3r18, 2.4 Å

PDB Description: chicken sulfite oxidase double mutant with altered activity and substrate affinity

PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d3r18a2:

Sequence; same for both SEQRES and ATOM records:

>d3r18a2 b.1.18.0 (A:344-466) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlmgvlstawhrvrvs
vqd

Timeline for d3r18a2:

• d3r18a2 first appeared in SCOPe 2.03
  
• d3r18a2 appears in SCOPe 2.05
  
• d3r18a2 appears in SCOPe 2.07
  
• d3r18a2 appears in the current release, SCOPe 2.08