Lineage for d3r0ka2 (3r0k A:128-363)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824117Species Francisella philomiragia [TaxId:484022] [226098] (5 PDB entries)
  8. 1824126Domain d3r0ka2: 3r0k A:128-363 [215508]
    Other proteins in same PDB: d3r0ka1, d3r0kb1
    automated match to d1wufa1
    complexed with gol, so4, tar

Details for d3r0ka2

PDB Entry: 3r0k (more details), 2 Å

PDB Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Tartrate bound, no Mg
PDB Compounds: (A:) Enzyme of enolase superfamily

SCOPe Domain Sequences for d3r0ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0ka2 c.1.11.0 (A:128-363) automated matches {Francisella philomiragia [TaxId: 484022]}
kansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldnefskni
kfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnipvvades
vfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmespagila
tasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaenlyf

SCOPe Domain Coordinates for d3r0ka2:

Click to download the PDB-style file with coordinates for d3r0ka2.
(The format of our PDB-style files is described here.)

Timeline for d3r0ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r0ka1