Lineage for d1tcra2 (1tcr A:118-213)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 9314Protein T-cell antigen receptor [49125] (4 species)
  7. 9328Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (4 PDB entries)
  8. 9329Domain d1tcra2: 1tcr A:118-213 [21549]
    Other proteins in same PDB: d1tcra1, d1tcrb1

Details for d1tcra2

PDB Entry: 1tcr (more details), 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone

SCOP Domain Sequences for d1tcra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcra2 b.1.1.2 (A:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOP Domain Coordinates for d1tcra2:

Click to download the PDB-style file with coordinates for d1tcra2.
(The format of our PDB-style files is described here.)

Timeline for d1tcra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tcra1