SCOP 1.65: Domain d1cqkb_: 1cqk B:

Lineage for d1cqkb_ (1cqk B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88591] (2 PDB entries)

8. Domain d1cqkb_: 1cqk B: [21548]
   CH-gamma-3 domain only from antibody MAK33
   mutant

Details for d1cqkb_

PDB Entry: 1cqk, 2.2 Å

PDB Description: crystal structure of the ch3 domain from the mak33 antibody

SCOP Domain Sequences for d1cqkb_:

Sequence; same for both SEQRES and ATOM records:

>d1cqkb_ b.1.1.2 (B:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus)}
paapqvytipppleqmakdlvsltcmitdffpeditvewqwngqpaenykntqpimdtdg
syfvysklnvqksnweagntftcsvlheglhnhhtekslsh

Timeline for d1cqkb_:

• d1cqkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqkb_ appears in SCOP 1.63
  
• d1cqkb_ appears in SCOP 1.67
  
• d1cqkb_ appears in the current release, SCOPe 2.08