Lineage for d1pfc__ (1pfc -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365577Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 365578Species Guinea pig (Cavia porcellus) [TaxId:10141] [49123] (1 PDB entry)
  8. 365579Domain d1pfc__: 1pfc - [21546]
    CH-gamma-3 domain only

Details for d1pfc__

PDB Entry: 1pfc (more details), 3.125 Å

PDB Description: molecular-replacement structure of guinea pig igg1 p*fc(prime) refined at 3.1 angstroms resolution

SCOP Domain Sequences for d1pfc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfc__ b.1.1.2 (-) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus)}
rtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykntp
pvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg

SCOP Domain Coordinates for d1pfc__:

Click to download the PDB-style file with coordinates for d1pfc__.
(The format of our PDB-style files is described here.)

Timeline for d1pfc__: