Lineage for d1pfc__ (1pfc -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) 
Species Fc (guinea pig) [49123] (1 PDB entry) 
Domain d1pfc__: 1pfc - [21546]
Details for d1pfc__
PDB Entry: 1pfc (more details), 3.125 Å
PDB Description: molecular-replacement structure of guinea pig igg1 p*fc(prime) refined at 3.1 angstroms resolution
SCOP Domain Sequences for d1pfc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfc__ b.1.1.2 (-) Immunoglobulin (constant domains of L and H chains) {Fc (guinea pig)}
rtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykntp
pvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg
SCOP Domain Coordinates for d1pfc__:
Click to download the PDB-style file with coordinates for d1pfc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pfc__:
- d1pfc__ appears in SCOP 1.57
- d1pfc__ appears in the current release, SCOPe 2.08, called d1pfca_
View in 3D