Lineage for d1frtc2 (1frt C:342-443)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293157Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 1293230Species Norway rat (Rattus norvegicus) [TaxId:10116] [88593] (3 PDB entries)
  8. 1293235Domain d1frtc2: 1frt C:342-443 [21545]
    Other proteins in same PDB: d1frta1, d1frta2, d1frtb_, d1frtc1
    part of a Fc
    complexed with nag

Details for d1frtc2

PDB Entry: 1frt (more details), 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc
PDB Compounds: (C:) igg fc

SCOPe Domain Sequences for d1frtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frtc2 b.1.1.2 (C:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d1frtc2:

Click to download the PDB-style file with coordinates for d1frtc2.
(The format of our PDB-style files is described here.)

Timeline for d1frtc2: