Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88588] (3 PDB entries) |
Domain d1frtc1: 1frt C:239-341 [21544] Other proteins in same PDB: d1frta1, d1frta2, d1frtb_, d1frtc2 part of a Fc complexed with nag |
PDB Entry: 1frt (more details), 4.5 Å
SCOPe Domain Sequences for d1frtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frtc1 b.1.1.2 (C:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]} svflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyns tyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg
Timeline for d1frtc1: