SCOP 1.65: Domain d1i1ad2: 1i1a D:342-443

Lineage for d1i1ad2 (1i1a D:342-443)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
Species Rat (Rattus norvegicus) [TaxId:10116] [88593] (2 PDB entries)
Domain d1i1ad2: 1i1a D:342-443 [21543]
Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab_, d1i1ac1, d1i1ad1
part of a Fc
complexed with cys, fuc, man, nag; mutant

Details for d1i1ad2

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

SCOP Domain Sequences for d1i1ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ad2 b.1.1.2 (D:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus)}
tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd
gsyflysklnvkketwqqgntftcsvlheglenehtekslsh

SCOP Domain Coordinates for d1i1ad2:

Click to download the PDB-style file with coordinates for d1i1ad2.
(The format of our PDB-style files is described here.)

Timeline for d1i1ad2: