Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (31 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [196438] (2 PDB entries) |
Domain d3qttb_: 3qtt B: [215411] automated match to d3n8hb_ complexed with anp, bal, mg, pro |
PDB Entry: 3qtt (more details), 2.6 Å
SCOPe Domain Sequences for d3qttb_:
Sequence, based on SEQRES records: (download)
>d3qttb_ c.26.1.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]} amiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnpt qfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegk srpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqp sglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrif lafyigkvrlidnflketgps
>d3qttb_ c.26.1.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]} amiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnpt qfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegk srpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqp sglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrif lafyigkvrlidnflkeps
Timeline for d3qttb_: