Lineage for d1i1ac1 (1i1a C:239-341)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9164Species Fc (rat) IgG [49122] (3 PDB entries)
  8. 9169Domain d1i1ac1: 1i1a C:239-341 [21540]
    Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab1

Details for d1i1ac1

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

SCOP Domain Sequences for d1i1ac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ac1 b.1.1.2 (C:239-341) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG}
svfifppktkdvltitltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
tlrsvselpivhrdwlngktfkckvnsgafpapieksiskpeg

SCOP Domain Coordinates for d1i1ac1:

Click to download the PDB-style file with coordinates for d1i1ac1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ac1: