SCOP 1.75: Domain d1i1cb2: 1i1c B:342-443

Lineage for d1i1cb2 (1i1c B:342-443)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88593] (2 PDB entries)

8. Domain d1i1cb2: 1i1c B:342-443 [21539]
   Other proteins in same PDB: d1i1ca1, d1i1cb1
   part of a Fc
   complexed with fuc, man, nag; mutant

Details for d1i1cb2

PDB Entry: 1i1c, 2.7 Å

PDB Description: non-fcrn binding fc fragment of rat igg2a

PDB Compounds: (B:) ig gamma-2a chain c region

SCOP Domain Sequences for d1i1cb2:

Sequence; same for both SEQRES and ATOM records:

>d1i1cb2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]}
tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd
gsyflysklnvkketwqqgntftcsvlheglenehtekslsh

Timeline for d1i1cb2:

• d1i1cb2 first appeared (with stable ids) in SCOP 1.55
  
• d1i1cb2 appears in SCOP 1.73
  
• d1i1cb2 appears in SCOPe 2.01
  
• d1i1cb2 appears in the current release, SCOPe 2.08