Lineage for d1i1cb2 (1i1c B:342-443)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9164Species Fc (rat) IgG [49122] (3 PDB entries)
  8. 9168Domain d1i1cb2: 1i1c B:342-443 [21539]

Details for d1i1cb2

PDB Entry: 1i1c (more details), 2.7 Å

PDB Description: non-fcrn binding fc fragment of rat igg2a

SCOP Domain Sequences for d1i1cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1cb2 b.1.1.2 (B:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG}
tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd
gsyflysklnvkketwqqgntftcsvlheglenehtekslsh

SCOP Domain Coordinates for d1i1cb2:

Click to download the PDB-style file with coordinates for d1i1cb2.
(The format of our PDB-style files is described here.)

Timeline for d1i1cb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1cb1