SCOPe 2.04: Domain d1i1cb1: 1i1c B:239-341

Lineage for d1i1cb1 (1i1c B:239-341)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88588] (3 PDB entries)

8. Domain d1i1cb1: 1i1c B:239-341 [21538]
   Other proteins in same PDB: d1i1ca2, d1i1cb2
   part of a Fc

Details for d1i1cb1

PDB Entry: 1i1c, 2.7 Å

PDB Description: non-fcrn binding fc fragment of rat igg2a

PDB Compounds: (B:) ig gamma-2a chain c region

SCOPe Domain Sequences for d1i1cb1:

Sequence; same for both SEQRES and ATOM records:

>d1i1cb1 b.1.1.2 (B:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
tlrsvselpiverdwlngktfkckvnsgafpapieksiskpeg

Timeline for d1i1cb1:

• d1i1cb1 first appeared (with stable ids) in SCOP 1.55
  
• d1i1cb1 appears in SCOPe 2.03
  
• d1i1cb1 appears in SCOPe 2.05
  
• d1i1cb1 appears in the current release, SCOPe 2.08