Lineage for d1i1cb1 (1i1c B:239-341)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221775Species Fc (rat) IgG [49122] (3 PDB entries)
  8. 221778Domain d1i1cb1: 1i1c B:239-341 [21538]

Details for d1i1cb1

PDB Entry: 1i1c (more details), 2.7 Å

PDB Description: non-fcrn binding fc fragment of rat igg2a

SCOP Domain Sequences for d1i1cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1cb1 b.1.1.2 (B:239-341) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG}
svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
tlrsvselpiverdwlngktfkckvnsgafpapieksiskpeg

SCOP Domain Coordinates for d1i1cb1:

Click to download the PDB-style file with coordinates for d1i1cb1.
(The format of our PDB-style files is described here.)

Timeline for d1i1cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1cb2