Lineage for d3qq9l2 (3qq9 L:112-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750087Domain d3qq9l2: 3qq9 L:112-217 [215362]
    Other proteins in same PDB: d3qq9c1, d3qq9d_, d3qq9h_, d3qq9l1
    automated match to d1rhha2
    complexed with so4

Details for d3qq9l2

PDB Entry: 3qq9 (more details), 1.64 Å

PDB Description: crystal structure of fab fragment of anti-human rsv (respiratory syncytial virus) f protein mab 101f
PDB Compounds: (L:) 101f light chain

SCOPe Domain Sequences for d3qq9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qq9l2 b.1.1.2 (L:112-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3qq9l2:

Click to download the PDB-style file with coordinates for d3qq9l2.
(The format of our PDB-style files is described here.)

Timeline for d3qq9l2: