Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d3qq9l2: 3qq9 L:112-217 [215362] Other proteins in same PDB: d3qq9c1, d3qq9d_, d3qq9h_, d3qq9l1 automated match to d1rhha2 complexed with so4 |
PDB Entry: 3qq9 (more details), 1.64 Å
SCOPe Domain Sequences for d3qq9l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qq9l2 b.1.1.2 (L:112-217) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d3qq9l2:
View in 3D Domains from other chains: (mouse over for more information) d3qq9c1, d3qq9c2, d3qq9d_, d3qq9h_ |