Lineage for d1i1ca1 (1i1c A:239-341)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 54013Species Fc (rat) IgG [49122] (3 PDB entries)
  8. 54014Domain d1i1ca1: 1i1c A:239-341 [21536]

Details for d1i1ca1

PDB Entry: 1i1c (more details), 2.7 Å

PDB Description: non-fcrn binding fc fragment of rat igg2a

SCOP Domain Sequences for d1i1ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG}
svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
tlrsvselpiverdwlngktfkckvnsgafpapieksiskpeg

SCOP Domain Coordinates for d1i1ca1:

Click to download the PDB-style file with coordinates for d1i1ca1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1ca2