SCOPe 2.04: Domain d3qpql2: 3qpq L:108-215

Lineage for d3qpql2 (3qpq L:108-215)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3qpql2: 3qpq L:108-215 [215356]
   Other proteins in same PDB: d3qpqc1, d3qpqe1, d3qpqi1, d3qpql1
   automated match to d1rhha2
   complexed with gol, so4

Details for d3qpql2

PDB Entry: 3qpq, 1.9 Å

PDB Description: crystal structure of anti-tlr3 antibody c1068 fab

PDB Compounds: (L:) C1068 light chain

SCOPe Domain Sequences for d3qpql2:

Sequence; same for both SEQRES and ATOM records:

>d3qpql2 b.1.1.2 (L:108-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d3qpql2:

• d3qpql2 first appeared in SCOPe 2.03
  
• d3qpql2 appears in SCOPe 2.05
  
• d3qpql2 appears in the current release, SCOPe 2.08