Lineage for d1f6ab2 (1f6a B:439-544)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365012Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)
  7. 365013Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)
  8. 365017Domain d1f6ab2: 1f6a B:439-544 [21533]
    Other proteins in same PDB: d1f6aa1, d1f6aa2, d1f6ab1, d1f6ad1

Details for d1f6ab2

PDB Entry: 1f6a (more details), 3.5 Å

PDB Description: Structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

SCOP Domain Sequences for d1f6ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6ab2 b.1.1.2 (B:439-544) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens)}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn

SCOP Domain Coordinates for d1f6ab2:

Click to download the PDB-style file with coordinates for d1f6ab2.
(The format of our PDB-style files is described here.)

Timeline for d1f6ab2: