SCOP 1.65: Domain d1f6ab2: 1f6a B:439-544

Lineage for d1f6ab2 (1f6a B:439-544)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)

8. Domain d1f6ab2: 1f6a B:439-544 [21533]
   Other proteins in same PDB: d1f6aa1, d1f6aa2, d1f6ab1, d1f6ad1

Details for d1f6ab2

PDB Entry: 1f6a, 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

SCOP Domain Sequences for d1f6ab2:

Sequence; same for both SEQRES and ATOM records:

>d1f6ab2 b.1.1.2 (B:439-544) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens)}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn

Timeline for d1f6ab2:

• d1f6ab2 first appeared (with stable ids) in SCOP 1.55
  
• d1f6ab2 appears in SCOP 1.63
  
• d1f6ab2 appears in SCOP 1.67
  
• d1f6ab2 appears in the current release, SCOPe 2.08