Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fc (human) IgE [49121] (2 PDB entries) |
Domain d1f6ab2: 1f6a B:439-544 [21533] Other proteins in same PDB: d1f6aa1, d1f6aa2 |
PDB Entry: 1f6a (more details), 3.5 Å
SCOP Domain Sequences for d1f6ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6ab2 b.1.1.2 (B:439-544) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE} praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn
Timeline for d1f6ab2:
View in 3D Domains from other chains: (mouse over for more information) d1f6aa1, d1f6aa2, d1f6ad1, d1f6ad2 |