SCOP 1.73: Domain d1f6ab1: 1f6a B:328-438

Lineage for d1f6ab1 (1f6a B:328-438)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon [88596] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88597] (3 PDB entries)

8. Domain d1f6ab1: 1f6a B:328-438 [21532]
   Other proteins in same PDB: d1f6aa1, d1f6aa2, d1f6ab2, d1f6ad2

Details for d1f6ab1

PDB Entry: 1f6a, 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

PDB Compounds: (B:) ig epsilon chain c region

SCOP Domain Sequences for d1f6ab1:

Sequence; same for both SEQRES and ATOM records:

>d1f6ab1 b.1.1.2 (B:328-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]}
pcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstr
keekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Timeline for d1f6ab1:

• d1f6ab1 first appeared (with stable ids) in SCOP 1.55
  
• d1f6ab1 appears in SCOP 1.71
  
• d1f6ab1 appears in SCOP 1.75
  
• d1f6ab1 appears in the current release, SCOPe 2.08